100+ datasets found
  1. c

    S1 File: Cohort database

    • ri.conicet.gov.ar
    • datosdeinvestigacion.conicet.gov.ar
    Updated Dec 1, 2022
    Share
    FacebookFacebook
    TwitterTwitter
    Email
    Click to copy link
    Link copied
    Close
    Cite
    Denninghoff, Valeria Cecilia; Fresno Rodríguez, Cristóbal (2022). S1 File: Cohort database [Dataset]. http://doi.org/10.1371/journal.pone.0278476
    Explore at:
    Dataset updated
    Dec 1, 2022
    Authors
    Denninghoff, Valeria Cecilia; Fresno Rodríguez, Cristóbal
    Description

    The Human Papillomavirus (HPV) test is a crucial technology for cervical cancer prevention because it enables programs to identify women with high-risk HPV infection who are at risk of developing cervical cancer. Current U.S. Preventive Services Task Force recommendations include cervical cancer screening every three years with cervical cytology alone or every five years with either high-risk HPV testing alone or high-risk HPV testing combined with cytology (co-testing). In Argentina, 7,548 new cervical cancer cases are diagnosed each year with 3,932 deaths attributed to this cause. Our study aims to show the clinical implementation of a cervical cancer screening program by concurrent HPV testing and cervical cytology (co-testing); and to evaluate the possible cervical cancer screening scenarios for Latin America, focusing on their performance and average cost. A cervical cancer screening five year program via co-testing algorithm (Hybrid-2-Capture/cytology) was performed on women aged 30-65 years old at a university hospital. Statistical analysis included a multinomial logistic regression, and two cancer screening classification alternatives were tested (cytology-reflex and HPV-reflex). A total of 2,273 women were included, 91.11% of the participants were double-negative, 2.55% double-positive, 5.90% positive-Hybrid-2-Capture-/negative-cytology, and 0.44% negative-Hybrid-2-Capture/positive-cytology. A thorough follow-up was performed in the positive-Hybrid-2-Capture group. Despite our efforts, 21 (10.93%) were lost, mainly because of changes on their health insurance coverage which excluded them from our screening algorithm. Of the 171 women with positive-Hybrid-2-Capture results and follow-up, 68 (39.77%) cleared the virus infection, 64 (37.43%) showed viral persistence, and 39 (22.81%) were adequately treated after detection via colposcopy/biopsy of histological HSIL (High-Grade Squamous Intraepithelial Lesion). The prevalence of high-risk HPV in this population was 192 women (8.45%), with HSIL histology detection rates of 17.32 per 1,000 screened women. A multinomial logistic regression analysis was performed over the women with positive-Hybrid-2-Capture considering the follow up (clearance, persistence and HSIL) as dependent variable, and the cytology test results (positive- or negative-cytology and Atypical Squamous Cells of Undetermined Significance, ASC-US) as independent variable. The model supported a direct association between cytology test results and follow up: negative-cytology/clearance, ASC-US/persistence, and positive-cytology/HSIL with the following probabilities of occurrence for these pairs 0.5, 0.647 and 0.647, respectively. Cytology could be considered a prognostic-factor in women with a positive-Hybrid-2-Capture. These findings suggest that the introduction of co-testing could diminish the burden of cervical cancer in low-and middle-income-countries, acting as a tool against inequity in healthcare.

  2. d

    HPV Sequence Database

    • dknet.org
    Updated Sep 5, 2024
    Share
    FacebookFacebook
    TwitterTwitter
    Email
    Click to copy link
    Link copied
    Close
    Cite
    (2024). HPV Sequence Database [Dataset]. http://identifiers.org/RRID:SCR_008154
    Explore at:
    Dataset updated
    Sep 5, 2024
    Description

    THIS RESOURCE IS NO LONGER IN SERVICE, documented May 10, 2017. A pilot effort that has developed a centralized, web-based biospecimen locator that presents biospecimens collected and stored at participating Arizona hospitals and biospecimen banks, which are available for acquisition and use by researchers. Researchers may use this site to browse, search and request biospecimens to use in qualified studies. The development of the ABL was guided by the Arizona Biospecimen Consortium (ABC), a consortium of hospitals and medical centers in the Phoenix area, and is now being piloted by this Consortium under the direction of ABRC. You may browse by type (cells, fluid, molecular, tissue) or disease. Common data elements decided by the ABC Standards Committee, based on data elements on the National Cancer Institute''s (NCI''s) Common Biorepository Model (CBM), are displayed. These describe the minimum set of data elements that the NCI determined were most important for a researcher to see about a biospecimen. The ABL currently does not display information on whether or not clinical data is available to accompany the biospecimens. However, a requester has the ability to solicit clinical data in the request. Once a request is approved, the biospecimen provider will contact the requester to discuss the request (and the requester''s questions) before finalizing the invoice and shipment. The ABL is available to the public to browse. In order to request biospecimens from the ABL, the researcher will be required to submit the requested required information. Upon submission of the information, shipment of the requested biospecimen(s) will be dependent on the scientific and institutional review approval. Account required. Registration is open to everyone., documented August 23, 2016. The Human Papillomaviruses Database collects, curates, analyzes, and publishes genetic sequences of papillomaviruses and related cellular proteins. It includes molecular biologists, sequence analysts, computer technicians, post-docs and graduate research assistants. This Web site has two main branches. The first contains our four annual data books of papillomavirus information, called Human Papillomaviruses: A Compilation and Analysis of Nucleic Acid and Amino Acid Sequences. and the second contains papillomavirus genetic sequence data. There is also a New Items location where we store the latest changes to the database or any other current news of interest. Besides the compendium, we also provide genetic sequence information for papilloma viruses and related cellular proteins. Each year they publish a compendium of papillomavirus information called Human Papillomaviruses: A Compilation and Analysis of Nucleic Acid and Amino Acid Sequences. which can now be downloaded from this Web site.

  3. Prevalence of Oral HPV Infections by Demographics in the NHANES and SEER...

    • plos.figshare.com
    xls
    Updated Jun 10, 2023
    Share
    FacebookFacebook
    TwitterTwitter
    Email
    Click to copy link
    Link copied
    Close
    Cite
    Prerna Tewari; Eugene Kashdan; Cathal Walsh; Cara M. Martin; Andrew C. Parnell; John J. O’Leary (2023). Prevalence of Oral HPV Infections by Demographics in the NHANES and SEER Datasets. [Dataset]. http://doi.org/10.1371/journal.pcbi.1009289.t001
    Explore at:
    xlsAvailable download formats
    Dataset updated
    Jun 10, 2023
    Dataset provided by
    PLOShttp://plos.org/
    Authors
    Prerna Tewari; Eugene Kashdan; Cathal Walsh; Cara M. Martin; Andrew C. Parnell; John J. O’Leary
    License

    Attribution 4.0 (CC BY 4.0)https://creativecommons.org/licenses/by/4.0/
    License information was derived automatically

    Description

    Prevalence of Oral HPV Infections by Demographics in the NHANES and SEER Datasets.

  4. f

    Database of the HPV and respiratory signal markers.

    • datasetcatalog.nlm.nih.gov
    • plos.figshare.com
    Updated Feb 16, 2021
    Share
    FacebookFacebook
    TwitterTwitter
    Email
    Click to copy link
    Link copied
    Close
    Cite
    Gelpi, Francesca; Porta, Alberto; Perego, Francesca; Parati, Monica; La Rovere, Maria Teresa; Vecchia, Laura Adelaide Dalla; Maestri, Roberto; Cairo, Beatrice; De Maria, Beatrice; Pinna, Gian Domenico; Bari, Vlasta (2021). Database of the HPV and respiratory signal markers. [Dataset]. https://datasetcatalog.nlm.nih.gov/dataset?q=0000894731
    Explore at:
    Dataset updated
    Feb 16, 2021
    Authors
    Gelpi, Francesca; Porta, Alberto; Perego, Francesca; Parati, Monica; La Rovere, Maria Teresa; Vecchia, Laura Adelaide Dalla; Maestri, Roberto; Cairo, Beatrice; De Maria, Beatrice; Pinna, Gian Domenico; Bari, Vlasta
    Description

    It contains time domain, frequency domain and HPVA markers as well durations of the INSP and EXP phases and I/E ratio in all the groups (i.e. H, CHF-II and CHF-III) during SB and CB. (XLSX)

  5. Table_1_HPV Positive Status Is a Favorable Prognostic Factor in...

    • frontiersin.figshare.com
    docx
    Updated Jun 1, 2023
    Share
    FacebookFacebook
    TwitterTwitter
    Email
    Click to copy link
    Link copied
    Close
    Cite
    Qiuji Wu; Miao Wang; Yixin Liu; Xulong Wang; Yi Li; Xiaoyan Hu; Ye Qiu; Wenjing Liang; Yongchang Wei; Yahua Zhong (2023). Table_1_HPV Positive Status Is a Favorable Prognostic Factor in Non-Nasopharyngeal Head and Neck Squamous Cell Carcinoma Patients: A Retrospective Study From the Surveillance, Epidemiology, and End Results Database.docx [Dataset]. http://doi.org/10.3389/fonc.2021.688615.s003
    Explore at:
    docxAvailable download formats
    Dataset updated
    Jun 1, 2023
    Dataset provided by
    Frontiers Mediahttp://www.frontiersin.org/
    Authors
    Qiuji Wu; Miao Wang; Yixin Liu; Xulong Wang; Yi Li; Xiaoyan Hu; Ye Qiu; Wenjing Liang; Yongchang Wei; Yahua Zhong
    License

    Attribution 4.0 (CC BY 4.0)https://creativecommons.org/licenses/by/4.0/
    License information was derived automatically

    Description

    ObjectiveTo investigate the impact of the human papillomavirus (HPV) status on head and neck squamous cell carcinoma (HNSCC) arising from different anatomic subsites.MethodsHNSCC patients with known HPV status from the Surveillance, Epidemiology, and End Results (SEER) database between 2010–2015 were included in our analysis. Patients were classified into three categories of HNSCC according to Site recode ICD-O-3/WHO 2008 and Primary Site-labeled, namely, oropharynx, hypopharynx, and nasopharynx. Logistic regression model was conducted to evaluate the relationship between patient characteristics and HPV status. Kaplan-Meier methods and COX regression analysis were used to analyze survival data.ResultsA total of 9,943 HNSCC patients with known HPV status from the SEER database were enrolled, with 6,829 (68.7%) HPV-positive patients. HPV-positive and HPV-negative HNSCC were distinct and had different clinical and socioeconomic features (all P < 0.001). Primary sites, socioeconomical factors (age, sex, marital status, and race), and pathological features (TNM stage and grade) were closely related with HPV status (all P < 0.001). HPV-positive status was a favorable prognostic marker in HNSCC patients with cancers of the oropharynx and hypopharynx (all P < 0.001), but was not in nasopharyngeal carcinoma patients (P = 0.843). A total of 8,933 oropharyngeal carcinoma (OPC) and 558 hypopharyngeal carcinoma (HPC) patients were divided into the training and validation cohorts with a ratio of 1:1. Significant prognostic factors of the OS yielded by multivariate COX analysis in the training cohort were integrated to construct nomograms for OPC and HPC patients. The prognostic models showed a good discrimination with a C-index of 0.79 ± 0.007 and 0.73 ± 0.023 in OPC and HPC, respectively. Favorable calibration was reflected by the calibration curves. Additionally, corresponding risk classification systems for OPC and HPC patients based on the nomograms were built and could perfectly classify patients into low-risk, intermediated-risk, high-risk groups. OS in the three risk groups was accurately differentiated and showed a good discrimination.ConclusionHPV positivity was associated with an improved survival in HNSCC patients with cancers of the oropharynx and hypopharynx. Nomograms and corresponding risk classification systems were constructed to assist clinicians in evaluating the survival of OPC and HPC patients.

  6. d

    Data from: Human papillomavirus DNA in plasma of patients with cervical...

    • catalog.data.gov
    • odgavaprod.ogopendata.com
    • +1more
    Updated Sep 7, 2025
    + more versions
    Share
    FacebookFacebook
    TwitterTwitter
    Email
    Click to copy link
    Link copied
    Close
    Cite
    National Institutes of Health (2025). Human papillomavirus DNA in plasma of patients with cervical cancer [Dataset]. https://catalog.data.gov/dataset/human-papillomavirus-dna-in-plasma-of-patients-with-cervical-cancer
    Explore at:
    Dataset updated
    Sep 7, 2025
    Dataset provided by
    National Institutes of Health
    Description

    Background Human papillomavirus (HPV) is a crucial etiological factor for cervical cancer (CC) development. From a diagnostic view-point, the consistent presence of HPV in CC allows the viral DNA to be used as a genetic marker. The aims of this study were to evaluate the presence, physical status and clinical significant of HPV DNA in circulation of CC patients. Results Whereas 6 out of 50 (12%) HPV positive CC patients revealed plasma HPV DNA, it was detected in none of 20 normal controls or 13 HPV negative CC cases. The plasma DNA exhibited an HPV type identical to the HPV in the primary tumors and the DNA from both sources was integrated into host genome. Interestingly, several findings suggested an association between plasma HPV DNA and metastasis. First, three of the HPV DNA positive cases were CC patients with clinical stage IVB or recurrence with distance metastases (P = 0.001, RR = 15.67). Second, the amount of plasma HPV DNA from metastatic patients to be three times more than three other patients without metastases. Finally, the later cases had tendency to develop recurrence distant metastases within one year after complete treatment when compared with other HPV associated CC patients with the same stage but without the present of plasma HPV DNA. Conclusions The plasma HPV DNA originated from the CC, was associated with metastasis and could be used as a marker representing the circulating free CC DNA.

  7. o

    Data from: Realising the promise of HPV vaccination – data from the national...

    • ourarchive.otago.ac.nz
    • tandf.figshare.com
    Updated Mar 3, 2025
    Share
    FacebookFacebook
    TwitterTwitter
    Email
    Click to copy link
    Link copied
    Close
    Cite
    Peter Sykes; Carrie Innes; Bryony Simcock; Beverley Lawton; Jonathan Williman (2025). Realising the promise of HPV vaccination – data from the national cervical screening and vaccination registers demonstrates the impact of HPV vaccination in Aotearoa New Zealand [Dataset]. https://ourarchive.otago.ac.nz/esploro/outputs/dataset/Realising-the-promise-of-HPV-vaccination/9926716968001891
    Explore at:
    Dataset updated
    Mar 3, 2025
    Dataset provided by
    Taylor & Francis / figshare
    Authors
    Peter Sykes; Carrie Innes; Bryony Simcock; Beverley Lawton; Jonathan Williman
    Time period covered
    Mar 3, 2025
    Area covered
    New Zealand
    Description

    The Aotearoa New Zealand (NZ) Cervical Screening Programme (NCSP) commenced in 1990. The NCSP has failed to equally reach its eligible population, consequently, cervical cancer rates by ethnicity are inequitable. In 2008, the Aotearoa NZ human papillomavirus (HPV) vaccination programme was introduced. The aim of this study was to determine the impact of HPV vaccination on the occurrence of high-grade cervical abnormalities and cancer in the cohort of people who were eligible for vaccination and underwent cervical screening. Data on the NCSP register were matched to the national vaccination register and the incidence of detected cervical abnormalities by vaccination status, ethnicity, birth cohort, and year of vaccination was determined. HPV vaccination was associated with a marked reduction in cervical cancer (hazard ratio [HR] 0.32) and adenocarcinoma in situ (HR 0.26). Vaccinated people were also less likely to experience a high-grade squamous cervical cytology (HR 0.75) or histology (HR 0.71). We observed equitable access to vaccination and protection against HSIL among Māori, Pacific, and European people. This data is important evidence of the real-world effectiveness of HPV vaccination in Aotearoa NZ. Vaccination improves outcomes equitably for Māori, Pacific peoples, and NZ Europeans. Increased vaccination rates are required for cervical cancer elimination.

  8. e

    Number of Human Papillomavirus Vaccine Doses Administered in Brazil by Age...

    • ebi.ac.uk
    Updated Oct 14, 2024
    Share
    FacebookFacebook
    TwitterTwitter
    Email
    Click to copy link
    Link copied
    Close
    Cite
    Matheus Santos Melo (2024). Number of Human Papillomavirus Vaccine Doses Administered in Brazil by Age and Sex from 2013 to 2023 and Population Cohorts for Coverage Calculation [Dataset]. http://doi.org/10.6019/S-BSST1683
    Explore at:
    Dataset updated
    Oct 14, 2024
    Authors
    Matheus Santos Melo
    License

    CC0 1.0 Universal Public Domain Dedicationhttps://creativecommons.org/publicdomain/zero/1.0/
    License information was derived automatically

    Description

    Database Description: Human Papillomavirus Vaccination in Brazil (2013-2023) This database contains information on human papillomavirus (HPV) vaccination in Brazil, distributed by year, age group, sex, and population cohorts from 2013 to 2023. The HPV vaccine is part of the national immunization schedule and is primarily aimed at preventing types of cancer associated with HPV, such as cervical cancer. The database is useful for analyzing vaccination coverage, trends over time, and assessing disparities in vaccination among different demographic groups. Additionally, the database includes information on population cohorts, which are used for calculating vaccination coverage. These cohorts represent the target population, divided by age group and sex, for each year of interest, allowing for precise analysis of the proportion of the population that has been immunized. Usage: The data can be used to: Analyze the evolution of vaccination coverage over time. Evaluate differences in vaccination across age groups and between sexes. Identify potential gaps in vaccination coverage and areas for intervention. Data Source: The data comes from official records of the National Immunization Program (PNI), maintained by the Brazilian Ministry of Health, as well as demographic data from the Brazilian Institute of Geography and Statistics (IBGE), based on annual reports and public health information systems.

  9. f

    Data from: Human papillomavirus (HPV) prevalence and associated risk factors...

    • datasetcatalog.nlm.nih.gov
    • plos.figshare.com
    Updated Jul 13, 2018
    + more versions
    Share
    FacebookFacebook
    TwitterTwitter
    Email
    Click to copy link
    Link copied
    Close
    Cite
    Kenter, Gemma; Benita, Edlyn; de Koning, Maurits N. C.; Lissenberg-Witte, Birgit I.; Kleinmoedig, Suhaina; Bravio, Igor Gomes; Pinedo, Herbert M.; Berkhof, Johannes; Meijer, Chris J. L. M.; Ardts, Kim; Hooi, Desiree J.; Quint, Wim G. V. (2018). Human papillomavirus (HPV) prevalence and associated risk factors in women from Curaçao [Dataset]. https://datasetcatalog.nlm.nih.gov/dataset?q=0000651132
    Explore at:
    Dataset updated
    Jul 13, 2018
    Authors
    Kenter, Gemma; Benita, Edlyn; de Koning, Maurits N. C.; Lissenberg-Witte, Birgit I.; Kleinmoedig, Suhaina; Bravio, Igor Gomes; Pinedo, Herbert M.; Berkhof, Johannes; Meijer, Chris J. L. M.; Ardts, Kim; Hooi, Desiree J.; Quint, Wim G. V.
    Area covered
    Curaçao
    Description

    BackgroundIn the Caribbean region, a notable difference in HPV-prevalence and genotypes distribution between the islands is observed. Recently we found in Curaçao a low incidence of HPV16 and 18 in cervical cancer compared to the standard world population. We aimed to determine HPV-prevalence, HPV-genotype distribution and associated risk-factors in women from Curaçao.Methods5000 women aged 25–65 years were randomly selected from the national Population Register. HPV was detected by means of GP5+/6+PCR EIA and GP 5+/6+amplimers from HPV-positive samples were genotyped with a reverse hybridisation assay. We also collected personal data and data on risk-factors.Results1075 women were enrolled in the study. Overall HPV-prevalence was 19.7%. Most frequent genotypes were HPV16 (2.3%), 35 (2.1%) and 52 (1.8%). Twenty-seven women detected with abnormal cytology (i.e.≥ASC-US) were referred for biopsy. In women with normal cytology (n = 1048), HPV-prevalence was 17.9% and the most common high-risk HPV (hrHPV)-types were HPV35 (2.0%), 18 (1.8%), 16 (1.5%) and 52 (1.5%). The highest HPV-prevalence (32.8%) was found in the age-group: 25–34 (n = 247). HPV positive women started sex at a younger age (p = 0.032).ConclusionsHPV-prevalence in the overall population is high and HPV16 was the most common genotype followed by 35 and 18. In women with normal cytology HPV35 is the most common genotype followed by HPV18, 52 and 16. The high HPV-prevalence (32.8%) in women of 25–34 years argue for introduction of cervical cancer prevention strategies. HPV-type distribution found in Curaçao should be taken into account when considering the choice for prophylactic vaccination.

  10. Data Sheet 1_The growing impact of human papilloma virus (HPV)-associated...

    • frontiersin.figshare.com
    docx
    Updated Jun 18, 2025
    + more versions
    Share
    FacebookFacebook
    TwitterTwitter
    Email
    Click to copy link
    Link copied
    Close
    Cite
    Sebastian Ospina-Henao; Francisco Brenes-Castillo; Marcel Marcano-Lozada; Maria Alejandra Betancur-Díaz; Sebastian Medina; Helena Brenes-Chacon; Maria L. Avila-Aguero (2025). Data Sheet 1_The growing impact of human papilloma virus (HPV)-associated cancers in men in Costa Rica: epidemiological and economic burden.docx [Dataset]. http://doi.org/10.3389/fpubh.2025.1487256.s002
    Explore at:
    docxAvailable download formats
    Dataset updated
    Jun 18, 2025
    Dataset provided by
    Frontiers Mediahttp://www.frontiersin.org/
    Authors
    Sebastian Ospina-Henao; Francisco Brenes-Castillo; Marcel Marcano-Lozada; Maria Alejandra Betancur-Díaz; Sebastian Medina; Helena Brenes-Chacon; Maria L. Avila-Aguero
    License

    Attribution 4.0 (CC BY 4.0)https://creativecommons.org/licenses/by/4.0/
    License information was derived automatically

    Description

    Human papillomavirus (HPV) is the most common sexually transmitted infection in men and women and is responsible for a substantial burden of disease worldwide. Although HPV-related disease burden is high in women due to cervical related disease and cancer, men are directly affected by HPV. According to the World Health Organization (WHO), one in three men has a prevalent HPV infection worldwide. Currently, there is a lack of data regarding the epidemiology and healthcare resource utilization (HCRU) of HPV-associated cancers among Costa Rican men. This study aimed to describe the epidemiological characteristics of HPV-associated male cancer and disease and the HCRU in Costa Rica. HPV-related cancers in men were assessed through retrospective database study for epidemiology and Delphi panel with five experts for HCRU. A total of 1,340 men with penile, anal, and head and neck cancers between 2012 and 2016 were identified in the database, with a mean age of 63.6 years. Anal cancer accounted for 48% of cases, followed by head and neck 44%, and penile cancer 11%. The cumulative rate of HPV-associated cancer in men per 100,000 population increased from 8.6 in 2012 to 55.5 in 2016. According to 4/5 panelists, resources for the disease management were also scarce. Panelists agreed that the cost for HPV management within their institution was 0.6–40,000 USD. Despite the increasing incidence e of HPV-related cancer in men, HPV prevention in men continues to be an under-served issue in public policy that could result in substantial economic and clinical burden. National health authorities should promote strategies to prevent HPV infections and associated diseases among Costa Rican men.

  11. a

    Data from: Human Papillomavirus Infection (HPV)

    • saratoga-county-community-health-hub-1-scphs.hub.arcgis.com
    Updated Aug 31, 2022
    Share
    FacebookFacebook
    TwitterTwitter
    Email
    Click to copy link
    Link copied
    Close
    Cite
    colleen.jason.scph (2022). Human Papillomavirus Infection (HPV) [Dataset]. https://saratoga-county-community-health-hub-1-scphs.hub.arcgis.com/datasets/498c4a6b5c254b279b025ee28c517b40
    Explore at:
    Dataset updated
    Aug 31, 2022
    Dataset authored and provided by
    colleen.jason.scph
    Description
  12. i

    Data from: Human papillomavirus (HPV) type 16-specific CD8+ T cell responses...

    • immunedata.org
    Updated Mar 1, 2004
    + more versions
    Share
    FacebookFacebook
    TwitterTwitter
    Email
    Click to copy link
    Link copied
    Close
    Cite
    (2004). Human papillomavirus (HPV) type 16-specific CD8+ T cell responses in women with high grade vulvar intraepithelial neoplasia. [Dataset]. http://www.immunedata.org/display-item.php?repository=0009&id=AWPUBUSGh18v6WY6RHTo&query=
    Explore at:
    Dataset updated
    Mar 1, 2004
    Description

    epitope description:AGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDI,antigen name:Protein E7,host organism:Homo sapiens,mhc allele name:HLA class I

  13. t

    BIOGRID CURATED DATA FOR PUBLICATION: Human papillomavirus (HPV)-18 E6...

    • thebiogrid.org
    zip
    Updated Jan 16, 2014
    Share
    FacebookFacebook
    TwitterTwitter
    Email
    Click to copy link
    Link copied
    Close
    Cite
    BioGRID Project (2014). BIOGRID CURATED DATA FOR PUBLICATION: Human papillomavirus (HPV)-18 E6 oncoprotein interferes with the epithelial cell polarity Par3 protein. [Dataset]. https://thebiogrid.org/256293/publication/human-papillomavirus-hpv-18-e6-oncoprotein-interferes-with-the-epithelial-cell-polarity-par3-protein.html
    Explore at:
    zipAvailable download formats
    Dataset updated
    Jan 16, 2014
    Dataset authored and provided by
    BioGRID Project
    License

    MIT Licensehttps://opensource.org/licenses/MIT
    License information was derived automatically

    Description

    Protein-Protein, Genetic, and Chemical Interactions for Facciuto F (2014):Human papillomavirus (HPV)-18 E6 oncoprotein interferes with the epithelial cell polarity Par3 protein. curated by BioGRID (https://thebiogrid.org); ABSTRACT: High-risk human papillomavirus (HPV) infection is the principal risk factor for the development of cervical cancer. The HPV E6 oncoprotein has the ability to target and interfere with several PSD-95/DLG/ZO-1 (PDZ) domain-containing proteins that are involved in the control of cell polarity. This function can be significant for E6 oncogenic activity because a deficiency in cell polarisation is a marker of tumour progression. The establishment and control of polarity in epithelial cells depend on the correct asymmetrical distribution of proteins and lipids at the cell borders and on specialised cell junctions. In this report, we have investigated the effects of HPV E6 protein on the polarity machinery, with a focus on the PDZ partitioning defective 3 (Par3) protein, which is a key component of tight junctions (TJ) and the polarity network. We demonstrate that E6 is able to bind and induce the mislocalisation of Par3 protein in a PDZ-dependent manner without significant reduction in Par3 protein levels. In addition, the high-risk HPV-18 E6 protein promotes a delay in TJ formation when analysed by calcium switch assays. Taken together, the data presented in this study contribute to our understanding of the molecular mechanism by which HPVs induce the loss of cell polarity, with potential implications for the development and progression of HPV-associated tumours.

  14. s

    India Hpv Export | List of Hpv Exporters & Suppliers

    • seair.co.in
    + more versions
    Share
    FacebookFacebook
    TwitterTwitter
    Email
    Click to copy link
    Link copied
    Close
    Cite
    Seair Exim Solutions, India Hpv Export | List of Hpv Exporters & Suppliers [Dataset]. https://www.seair.co.in/hpv-export-data.aspx
    Explore at:
    .text/.csv/.xml/.xls/.binAvailable download formats
    Dataset authored and provided by
    Seair Exim Solutions
    Area covered
    India
    Description

    Explore Indian Hpv export data with HS codes, pricing, ports, and a verified list of Hpv exporters and suppliers from India with complete shipment insights.

  15. Human papillomavirus (HPV) vaccine coverage estimates in England: 2023 to...

    • gov.uk
    Updated Jun 24, 2025
    Share
    FacebookFacebook
    TwitterTwitter
    Email
    Click to copy link
    Link copied
    Close
    Cite
    UK Health Security Agency (2025). Human papillomavirus (HPV) vaccine coverage estimates in England: 2023 to 2024 [Dataset]. https://www.gov.uk/government/statistics/human-papillomavirus-hpv-vaccine-coverage-estimates-in-england-2023-to-2024
    Explore at:
    Dataset updated
    Jun 24, 2025
    Dataset provided by
    GOV.UKhttp://gov.uk/
    Authors
    UK Health Security Agency
    Area covered
    England
    Description

    Human papillomavirus (HPV) vaccine coverage data for vaccinations received by year 8, year 9 and year 10 females and males, by local authority and NHS England local team: academic year 2023 to 2024.

  16. HPV (Human Papillomavirus) seroprevalence in GUM (Genito-Urinary Medicine)...

    • ckan.publishing.service.gov.uk
    Updated Aug 30, 2013
    + more versions
    Share
    FacebookFacebook
    TwitterTwitter
    Email
    Click to copy link
    Link copied
    Close
    Cite
    ckan.publishing.service.gov.uk (2013). HPV (Human Papillomavirus) seroprevalence in GUM (Genito-Urinary Medicine) attendees - Dataset - data.gov.uk [Dataset]. https://ckan.publishing.service.gov.uk/dataset/hpv-human-papillomavirus-seroprevalence-in-gum-genito-urinary-medicine-attendees
    Explore at:
    Dataset updated
    Aug 30, 2013
    Dataset provided by
    CKANhttps://ckan.org/
    Description

    HPV (Human Papillomavirus) seroprevalence in GUM (Genito-Urinary Medicine) attendees identified using the Genito-Urinary Medicine Clinic Activity Dataset - GUMCAD data

  17. Cervical Cancer & HPV Vaccines

    • kaggle.com
    zip
    Updated Oct 26, 2023
    Share
    FacebookFacebook
    TwitterTwitter
    Email
    Click to copy link
    Link copied
    Close
    Cite
    Joakim Arvidsson (2023). Cervical Cancer & HPV Vaccines [Dataset]. https://www.kaggle.com/datasets/joebeachcapital/cervical-cancer-and-hpv-vaccines
    Explore at:
    zip(608329 bytes)Available download formats
    Dataset updated
    Oct 26, 2023
    Authors
    Joakim Arvidsson
    License

    Attribution 4.0 (CC BY 4.0)https://creativecommons.org/licenses/by/4.0/
    License information was derived automatically

    Description

    The Economist's Cervical Cancer & HPV Vaccines data used in the article: article: https://www.economist.com/graphic-detail/2023/05/31/cheap-single-dose-hpv-vaccines-could-save-millions-of-lives author: Daniella Raz

    Sources

    The World Health Organization / UNICEF
    Papillomavirus Rapid Interface for Modelling and Economics (PRIME): London School of Hygiene & Tropical Medicine, Mark Jit, Marc Brisson, Kaja Abbas, and Han Fu
    

    Variable definitions

    by age 15, first dose:

    by age 15, last dose:

    coverage, first dose, females:

    coverage, last dose, females:

    country = country code

    cohort_size = total number of girls who are in the cohort that should be getting vaccinated

    current_cov = coverage in X year

    curr_vacc_cohort_size = number vaccinated in that cohort

    future_cov = 90% coverage rate

    future_vacc_cohort_size = number vaccinated in cohort under new coverage rate

    curr_cc_prev: cervical cancer cases prevented under the current coverage

    curr_mort_prev: deaths from cervical cancer prevented under the current coverage

    curr_cost: current cost of the program

    curr_cost_prev: current costs prevented by reducing cervical cancer

    proj_cc_prev, proj_mort_prev, proj_cost, proj_cost_prev are the same as above but under the "projected" 90% coverage rate the WHO says is necessary for elimination of cervical cancer

  18. d

    National Human Papilloma Vaccination Program Register

    • data.gov.au
    • data.wu.ac.at
    html
    Updated Nov 19, 2015
    + more versions
    Share
    FacebookFacebook
    TwitterTwitter
    Email
    Click to copy link
    Link copied
    Close
    Cite
    Department of Health (2015). National Human Papilloma Vaccination Program Register [Dataset]. https://data.gov.au/data/dataset/groups/national-human-papilloma-vaccination-program-register
    Explore at:
    htmlAvailable download formats
    Dataset updated
    Nov 19, 2015
    Dataset provided by
    Department of Health
    Description

    The National HPV Vaccination Program Register (HPV Register) is a database that collects details about HPV vaccinations given in Australia. National HPV coverage data is published as a suite of vaccination coverage tables.

    Data is available for research purposes at detailed aggregate and unit record levels under terms and conditions that ensure compliance with the relevant legislation under which the collection has been made.

    A range of aggregate data has been made available on the Internet for public use.

    Data available includes:

    • National HPV 3 dose coverage for females

    • HPV coverage for females by dose by age group

    • HPV coverage for females by year of age

  19. f

    Data of research.

    • datasetcatalog.nlm.nih.gov
    • plos.figshare.com
    Updated Aug 29, 2024
    Share
    FacebookFacebook
    TwitterTwitter
    Email
    Click to copy link
    Link copied
    Close
    Cite
    de Melo Neto, João Simão; dos Santos, Gabriela Sepêda; Navegante, Aline Carvalho Gonçalves; Luz, Marlucia Oliveira; Júnior, José Ribamar Leal Dias; Pierre, Marie Esther; dos Reis Galhardo, Deizyane; de Campos Gomes, Fabiana; Dias, Helana Augusta Andrade Leal (2024). Data of research. [Dataset]. https://datasetcatalog.nlm.nih.gov/dataset?q=0001281411
    Explore at:
    Dataset updated
    Aug 29, 2024
    Authors
    de Melo Neto, João Simão; dos Santos, Gabriela Sepêda; Navegante, Aline Carvalho Gonçalves; Luz, Marlucia Oliveira; Júnior, José Ribamar Leal Dias; Pierre, Marie Esther; dos Reis Galhardo, Deizyane; de Campos Gomes, Fabiana; Dias, Helana Augusta Andrade Leal
    Description

    IntroductionGenetic variants may influence Toll-like receptor (TLR) signaling in the immune response to human papillomavirus (HPV) infection and lead to cervical cancer. In this study, we investigated the pattern of TLR expression in the transcriptome of HPV-positive and HPV-negative cervical cancer samples and looked for variants potentially related to TLR gene alterations in exomes from different populations.Materials and methodsA cervical tissue sample from 28 women, which was obtained from the Gene Expression Omnibus database, was used to examine TLR gene expression. Subsequently, the transcripts related to the TLRs that showed significant gene expression were queried in the Genome Aggregation Database to search for variants in more than 5,728 exomes from different ethnicities.ResultsCancer and HPV were found to be associated (p<0.0001). TLR1(p = 0.001), TLR3(p = 0.004), TLR4(221060_s_at)(p = 0.001), TLR7(p = 0.001;p = 0.047), TLR8(p = 0.002) and TLR10(p = 0.008) were negatively regulated, while TLR4(1552798_at)(p<0.0001) and TLR6(p = 0.019) were positively regulated in HPV-positive patients (p<0.05). The clinical significance of the variants was statistically significant for TLR1, TLR3, TLR6 and TLR8 in association with ethnicity. Genetic variants in different TLRs have been found in various ethnic populations. Variants of the TLR gene were of the following types: TLR1(5_prime_UTR), TLR4(start_lost), TLR8(synonymous;missense) and TLR10(3_prime_UTR). The “missense” variant was found to have a risk of its clinical significance being pathogenic in South Asian populations (OR = 56,820[95%CI:40,206,80,299]).ConclusionThe results of this study suggest that the variants found in the transcriptomes of different populations may lead to impairment of the functional aspect of TLRs that show significant gene expression in cervical cancer samples caused by HPV.

  20. U

    Test: Expression data from HPV cancer cell lines

    • dataverse-staging.rdmc.unc.edu
    Updated Sep 29, 2016
    Share
    FacebookFacebook
    TwitterTwitter
    Email
    Click to copy link
    Link copied
    Close
    Cite
    Rolando Garcia-Milian; Rolando Garcia-Milian (2016). Test: Expression data from HPV cancer cell lines [Dataset]. https://dataverse-staging.rdmc.unc.edu/dataset.xhtml?persistentId=hdl:1902.29/11289
    Explore at:
    text/plain; charset=us-ascii(2672485)Available download formats
    Dataset updated
    Sep 29, 2016
    Dataset provided by
    UNC Dataverse
    Authors
    Rolando Garcia-Milian; Rolando Garcia-Milian
    License

    https://dataverse-staging.rdmc.unc.edu/api/datasets/:persistentId/versions/2.1/customlicense?persistentId=hdl:1902.29/11289https://dataverse-staging.rdmc.unc.edu/api/datasets/:persistentId/versions/2.1/customlicense?persistentId=hdl:1902.29/11289

    Description

    Datasets containing the results of gene expression analysis using GEO2R for different HPV cancer cell lines and normal samples.

Share
FacebookFacebook
TwitterTwitter
Email
Click to copy link
Link copied
Close
Cite
Denninghoff, Valeria Cecilia; Fresno Rodríguez, Cristóbal (2022). S1 File: Cohort database [Dataset]. http://doi.org/10.1371/journal.pone.0278476

S1 File: Cohort database

Explore at:
4 scholarly articles cite this dataset (View in Google Scholar)
Dataset updated
Dec 1, 2022
Authors
Denninghoff, Valeria Cecilia; Fresno Rodríguez, Cristóbal
Description

The Human Papillomavirus (HPV) test is a crucial technology for cervical cancer prevention because it enables programs to identify women with high-risk HPV infection who are at risk of developing cervical cancer. Current U.S. Preventive Services Task Force recommendations include cervical cancer screening every three years with cervical cytology alone or every five years with either high-risk HPV testing alone or high-risk HPV testing combined with cytology (co-testing). In Argentina, 7,548 new cervical cancer cases are diagnosed each year with 3,932 deaths attributed to this cause. Our study aims to show the clinical implementation of a cervical cancer screening program by concurrent HPV testing and cervical cytology (co-testing); and to evaluate the possible cervical cancer screening scenarios for Latin America, focusing on their performance and average cost. A cervical cancer screening five year program via co-testing algorithm (Hybrid-2-Capture/cytology) was performed on women aged 30-65 years old at a university hospital. Statistical analysis included a multinomial logistic regression, and two cancer screening classification alternatives were tested (cytology-reflex and HPV-reflex). A total of 2,273 women were included, 91.11% of the participants were double-negative, 2.55% double-positive, 5.90% positive-Hybrid-2-Capture-/negative-cytology, and 0.44% negative-Hybrid-2-Capture/positive-cytology. A thorough follow-up was performed in the positive-Hybrid-2-Capture group. Despite our efforts, 21 (10.93%) were lost, mainly because of changes on their health insurance coverage which excluded them from our screening algorithm. Of the 171 women with positive-Hybrid-2-Capture results and follow-up, 68 (39.77%) cleared the virus infection, 64 (37.43%) showed viral persistence, and 39 (22.81%) were adequately treated after detection via colposcopy/biopsy of histological HSIL (High-Grade Squamous Intraepithelial Lesion). The prevalence of high-risk HPV in this population was 192 women (8.45%), with HSIL histology detection rates of 17.32 per 1,000 screened women. A multinomial logistic regression analysis was performed over the women with positive-Hybrid-2-Capture considering the follow up (clearance, persistence and HSIL) as dependent variable, and the cytology test results (positive- or negative-cytology and Atypical Squamous Cells of Undetermined Significance, ASC-US) as independent variable. The model supported a direct association between cytology test results and follow up: negative-cytology/clearance, ASC-US/persistence, and positive-cytology/HSIL with the following probabilities of occurrence for these pairs 0.5, 0.647 and 0.647, respectively. Cytology could be considered a prognostic-factor in women with a positive-Hybrid-2-Capture. These findings suggest that the introduction of co-testing could diminish the burden of cervical cancer in low-and middle-income-countries, acting as a tool against inequity in healthcare.

Search
Clear search
Close search
Google apps
Main menu